PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017049
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 398aa    MW: 43101.1 Da    PI: 10.07
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017049genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.11.1e-14298351558
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk+ l el+ + ++
  Lus10017049 298 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENNQLKQALVELERKRKQ 351
                  79*****************************************99999987764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-14291350No hitNo description
SMARTSM003384.8E-14294358IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.714296348IPR004827Basic-leucine zipper domain
PfamPF001701.5E-12298351IPR004827Basic-leucine zipper domain
CDDcd147074.11E-23298352No hitNo description
SuperFamilySSF579592.56E-10298347No hitNo description
PROSITE patternPS000360301316IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MVATRPDQDM NSQGEVDSPL QQLNHQSNKN QPSTTPLGRQ SSIYSLTLDE FQHTLCEGGK  60
NFGSMNMDEF INSIWTAEEN QGAAAHTSNS ATAVANNHSG RDTTTNSAGL GISKQPSLPR  120
QGSLTLPEKL CRKTVDEVWS EIHNGRGSRS GQRKGSEGTT NSGADMQNAG SVPRQPTFGE  180
MTLEDFLVKA GVVRGQQQQG GGGSSVAAAS IPPAPQQYSS MYQNPVAAYQ SILPHVQPGD  240
VYGGVGAGYA MVRPNSPVSS DGMLGNMDGV GNQYGMDIGG LRGRKRVIDG PVEKVVERRQ  300
RRMIKNRESA ARSRARKQAY TVELEAELNQ LKEENNQLKQ ALVELERKRK QKVAVSKANL  360
PGLNSKNVEE ARTRGQSKAQ KARENLRLMR RNLSCPL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012066490.11e-132PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
SwissprotQ9SJN01e-106ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A067L6C21e-132A0A067L6C2_JATCU; Uncharacterized protein
STRINGSolyc09g009490.2.11e-122(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20923374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.17e-55bZIP family protein